PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004504870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 28371.2 Da    PI: 8.4616
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004504870.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.71.2e-26959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +rien+s rqvtf+kR++g++KKAeELS+LCda+v +i+fs t kly+y+s
  XP_004504870.1  9 ERIENSSSRQVTFAKRKKGLMKKAEELSILCDAQVGLIVFSCTHKLYDYAS 59
                    69***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.497161IPR002100Transcription factor, MADS-box
CDDcd002654.92E-40277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-25323IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-30386IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-253859IPR002100Transcription factor, MADS-box
PfamPF014861.8E-2686171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.60587177IPR002487Transcription factor, K-box
Gene3DG3DSA:1.20.5.1704.9E-4137185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MRRGKIVIER IENSSSRQVT FAKRKKGLMK KAEELSILCD AQVGLIVFSC THKLYDYASS  60
SMESTIERYS KLAEDRHHSM NPTTWDVQFW QSEASNLRKQ LQHLKNWQRQ VMGQELSGLE  120
FNELQHLENQ LEMSLKNIRM RKDQMFSDEI KELHKKENLC SQENEELHKK IDLIGEENAK  180
LNKLIGAARR AEYATSNPSC SSISYGYYDK HDEPISLQLS QAQPQYNEPP ARANNMGSCL  240
KLRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D9e-19374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-19374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-19374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A9e-19374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-18374273Myocyte-specific enhancer factor 2A
3p57_I1e-18374273Myocyte-specific enhancer factor 2A
3p57_D1e-18374273Myocyte-specific enhancer factor 2A
3p57_C1e-18374273Myocyte-specific enhancer factor 2A
3p57_B1e-18374273Myocyte-specific enhancer factor 2A
3p57_A1e-18374273Myocyte-specific enhancer factor 2A
3kov_J1e-18374273Myocyte-specific enhancer factor 2A
3kov_I1e-18374273Myocyte-specific enhancer factor 2A
3kov_B1e-18374273Myocyte-specific enhancer factor 2A
3kov_A1e-18374273Myocyte-specific enhancer factor 2A
1tqe_S1e-18174174Myocyte-specific enhancer factor 2B
1tqe_R1e-18174174Myocyte-specific enhancer factor 2B
1tqe_Q1e-18174174Myocyte-specific enhancer factor 2B
1tqe_P1e-18174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004504870.10.0PREDICTED: MADS-box transcription factor 23
SwissprotQ9SZJ67e-72AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLA0A0R0G6772e-92A0A0R0G677_SOYBN; Uncharacterized protein
TrEMBLG7IS853e-92G7IS85_MEDTR; MADS-box transcription factor
STRINGGLYMA13G32810.15e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF8912560
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.14e-73AGAMOUS-like 21